Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003379) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Fab Glenzocimab
|
|||||
| Synonyms |
ACT-017
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Phase II | |||||
| SBP Sequence |
>VH Chain
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYNMHWVRQAPGQGLEWMGGIYPGNGDTSY NQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGTVVGDWYFDVWGQGTLVTVSS >VL Chain DIQMTQSPSSLSASVGDRVTITCRSSQSLENSNGNTYLNWYQQKPGKAPKLLIYRVSNRF SGVPSRFSGSGSGRDFTFTISSLQPEDIATYYCLQLTHVPWTFGQGTKVEIT |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS034 | [1] | ||||
| Scaffold Name | Fab | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Platelet glycoprotein VI | Inhibitor | Stroke [ICD-11: 8B20]; SARS-CoV-2 infection (COVID-19) [ICD-11: XN109] | N.A. | LYO-X GmbH; Acticor Biotech | [1] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT03803007 | Click to show the Detail | |||||
| Indication | Acute Ischemic Stroke | |||||
| Phase | Phase I; Phase II | |||||
| Title | Acute Ischemic Stroke Interventional Study | |||||
| Status | . | |||||
| Sponsor | Acticor Biotech | |||||
| NCT04659109 | Click to show the Detail | |||||
| Indication | COVID-19 | |||||
| Phase | Phase II | |||||
| Title | Glenzocimab in SARS-Cov-2 Acute Respiratory DistrEss syNdrome Related to COVID-19 | |||||
| Status | Recruiting | |||||
| Sponsor | Acticor Biotech | |||||
| NCT05070260 | Click to show the Detail | |||||
| Indication | Acute Ischemic Stroke | |||||
| Phase | Phase II; Phase III | |||||
| Title | ACTISAVE: ACuTe Ischemic Stroke Study Evaluating Glenzocimab Used as Add-on Therapy Versus placEbo | |||||
| Status | Active, not recruiting | |||||
| Sponsor | Acticor Biotech | |||||
| NCT05559398 | Click to show the Detail | |||||
| Indication | Stroke, Acute; Stroke, Ischemic | |||||
| Phase | Phase II; Phase III | |||||
| Title | Glenzocimab for REperfusion in the Setting of Endovascular Therapy for Brain infarctioN: GREEN Study | |||||
| Status | Not yet recruiting | |||||
| Sponsor | Assistance Publique - H?pitaux de Paris | |||||