Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003374)
SBP Name
Fab Dapirolizumab
Synonyms
CDP7657
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Highest Status Phase III
SBP Sequence
>VH Chain
EVQLVESGGGLVQPGGSLRLSCAVSGFSSTNYHVHWVRQAPGKGLEWMGVIWGDGDTSYN
SVLKSRFTISRDTSKNTVYLQMNSLRAEDTAVYYCARQLTHYYVLAAWGQGTLVTVSS
>VL Chain
DIQMTQSPSSLSASVGDRVTITCRASEDLYYNLAWYQRKPGKAPKLLIYDTYRLADGVPS
RFSGSGSGTDYTLTISSLQPEDFASYYCQQYYKFPFTFGQGTKVEIK
Protein Scaffold Information of This SBP
Scaffold ID PS034
Scaffold Info
[1]
Scaffold Name Fab
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
CD40 ligand
BTS Info
Inhibitor Systemic lupus erythematosus [ICD-11: 4A40.0]; Multiple sclerosis [ICD-11: 8A40.Z]; Amyotrophic lateral sclerosis [ICD-11: 8B60.0]; Rheumatoid Arthritis [ICD-11: FA20.Z] N.A. UCB Pharma; Biogen Idec [1]
Clinical Trial Information of This SBP
NCT02804763 Click to show the Detail
Indication Systemic Lupus Erythematosus (SLE)
Phase Phase II
Title A Phase II Efficacy and Safety Study of Dapirolizumab Pegol (DZP) in Systemic Lupus Erythematosus
Status Completed
Sponsor UCB Biopharma S.P.R.L.
NCT04294667 Click to show the Detail
Indication Systemic Lupus Erythematosus
Phase Phase III
Title A Study to Evaluate the Efficacy and Safety of Dapirolizumab Pegol in Study Participants With Moderately to Severely Active Systemic Lupus Erythematosus
Status Recruiting
Sponsor UCB Biopharma SRL
NCT04571424 Click to show the Detail
Indication Healthy Volunteers
Phase Phase I
Title A Study to Evaluate Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of BIIB133 (Dapirolizumab Pegol) in Healthy Japanese and Caucasian Participants
Status Completed
Sponsor Biogen
NCT04976322 Click to show the Detail
Indication Systemic Lupus Erythematosus
Phase Phase III
Title A Study to Evaluate the Safety and Tolerability of Dapirolizumab Pegol in Study Participants With Systemic Lupus Erythematosus
Status Enrolling by invitation
Sponsor UCB Biopharma SRL
References
1 Repeated administration of dapirolizumab pegol in a randomised phase I study is well tolerated and accompanied by improvements in several composite measures of systemic lupus erythematosus disease activity and changes in whole blood transcriptomic profiles. Ann Rheum Dis. 2017 Nov;76(11):1837-1844.