Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00076) | ||||||
---|---|---|---|---|---|---|
BTS Name |
CD40 ligand
|
|||||
Synonyms |
CD40-L; T-cell antigen Gp39; TNF-related activation protein; TRAP; Tumor necrosis factor ligand superfamily member 5; CD antigen CD154
|
|||||
BTS Type |
Protein
|
|||||
Family |
Tumor necrosis factor family
|
|||||
Gene Name |
CD40LG
|
|||||
Organism |
Homo sapiens (Human)
|
|||||
Function |
Cytokine that acts as a ligand to CD40/TNFRSF5 Costimulates T-cell proliferation and cytokine production Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation Induces the activation of NF-kappa-B Induces the activation of kinases MAPK8 and PAK2 in T-cells Induces tyrosine phosphorylation of isoform 3 of CD28 Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4 (By similarity). Involved in immunoglobulin class switching (By similarity).; [CD40 ligand, soluble form]: Acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling.
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN VTDPSQVSHGTGFTSFGLLKL |
|||||
Sequence Length |
261
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
Avimer anti-CD40L C65 | Research | Inhibitor | Kd: <0.1 nM | Research tool | [1] | |
Fab Dapirolizumab | Phase III | Inhibitor | N.A. | Systemic lupus erythematosus [ICD-11: 4A40.0]; Multiple sclerosis [ICD-11: 8A40.Z]; Amyotrophic lateral sclerosis [ICD-11: 8B60.0]; Rheumatoid Arthritis [ICD-11: FA20.Z] | [2] | |
References |
---|