Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003368) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Fab Abrezekimab
|
|||||
| Synonyms |
VR 942; UCB4144
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Phase I | |||||
| SBP Sequence |
>VH Chain
QVTLKESGPVLVKPTETLTLTCTVSGFSLTNYHVQWIRQPPGKALEWLGVMWSDGDTSFN SVLKSRLTISRDTSKSQVVLTMTNMDPVATYYCARDGTIAAMDYFDYWGQGTLVTVSS >VL Chain DIQMTQSPSSLSASVGDRVTITCLASEDISNYLAWYQQKPGKAPKLLIYHTSRLQDGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCGYRFPLTFGGGTKVEIK |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS034 | [1] | ||||
| Scaffold Name | Fab | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Interleukin-13 | Binder | Asthma [ICD-11: CA23] | N.A. | UCB Pharma; Vectura | [1] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT02473939 | Click to show the Detail | |||||
| Indication | Healthy Subjects and Repeated Doses in Mild Asthmatics | |||||
| Phase | Phase I | |||||
| Title | A Randomised, Double-blind, Placebo-controlled, Dose-escalation Study to Evaluate the Safety, Tolerability, Pharmacodynamics and Pharmacokinetics of Single Inhaled Doses of VR942 in Healthy Subjects and Repeated Doses in Mild Asthmatics | |||||
| Status | Completed | |||||
| Sponsor | Vectura Limited | |||||