General Information of Synthetic Binding Protein (SBP) (ID: SBP003281)
SBP Name
scFv anti-BAFF ABL-1
Synonyms
scFv ABL-1
Molecular Weight 24.8 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Highest Status Research
Sequence Length 235
SBP Sequence
>scFv anti-BAFF ABL-1
VQLQESGGGLVQPGGSLRLSCATSGFTFTDYVMSWVRQPPGKALEWLGFIRNKANGYTTE
YSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDITLLGQGTTVTVSSGGGGSG
GGGSGGGGSDIELTQSPAIMSASLGERVTMTCTASSSVSSSYLHWYQQKPGSSPKLWIYS
TSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQYHRSPYTFGGGTKLE
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Monoclonal antibody ABL-1
Protein Scaffold Information of This SBP
Scaffold ID PS057
Scaffold Info
[1]
Scaffold Name scFv
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Tumor necrosis factor ligand superfamily member 13B
BTS Info
Binder Research tool Kd: 9 nM Nanjing Normal University [1]
References
1 Production and characterization of a bacterial single-chain antibody fragment specific to B-cell-activating factor of the TNF family. Protein Expr Purif. 2005 Oct;43(2):157-64.