Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003263) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv anti-C3 MA11
|
|||||
| Synonyms |
scFv MA11
|
|||||
| Molecular Weight | 24.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 240 | |||||
| SBP Sequence |
>scFv anti-C3 MA11
QSLEESGGRLVTPGTPLTLTCTVSGFSVSSYAMAWVRQAPGRGLEWIGIINTGGDTYYAN WAKGRFTISKTSTTVDLKITSPTTEDTATYFCTRGGTFGYINVDYYNIWGQGTLVTGGGG SGGGGSGGGGSALDLTQTPASVEVAVGGTVTIKCQASESISSYLAWYQQKPGQPPKLLIY SASTLASGVSSRFKGSGSGTEFTLTISDLECADAATYYCQQGYSSSNVYNLFGGGTEVVK |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Complement C3 | Binder | Research tool | N.A. | Medical School Hannover | [1] | |