Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003250) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-ADRB2 clone c206
|
|||||
Synonyms |
Nb.c206
|
|||||
Molecular Weight | 14.2 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Yeast display | |||||
Highest Status | Research | |||||
Sequence Length | 128 | |||||
SBP Sequence |
>Nanobody anti-ADRB2 clone c206
QVQLQESGGGLVQAGGSLRLSCAASGYISDAYYMGWYRQAPGKEREFVATITHGTNTYYA DSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVHDINSYLSLEGFWVDHVYWGQGT QVTVSSLE |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Beta-2 adrenergic receptor | Modulator | Research tool | Kd: 44-151 nM | Harvard Medical School | [1] | |