General Information of Synthetic Binding Protein (SBP) (ID: SBP003245)
SBP Name
Nanobody anti-ADRB2 clone c201
Synonyms
Nb.c201
Molecular Weight 13.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Yeast display
Highest Status Research
Sequence Length 120
SBP Sequence
>Nanobody anti-ADRB2 clone c201
QVQLQESGGGLVQAGGSLRLSCAASGYISDAYYMGWYRQAPGKEREFVATITHGTNTYYA
DSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVYTSWYSPYIYWGQGTQVTVSSLE
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Beta-2 adrenergic receptor
BTS Info
Modulator Research tool Kd: 44-151 nM Harvard Medical School [1]
References
1 Yeast surface display platform for rapid discovery of conformationally selective nanobodies. Nat Struct Mol Biol. 2018 Mar;25(3):289-296.