Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003194) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-ICMT MB-15
|
|||||
| Synonyms |
Monobody MB-15
|
|||||
| Molecular Weight | 10.1 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display and yeast display | |||||
| Highest Status | Research | |||||
| PDB ID | 5V7P | |||||
| Sequence Length | 95 | |||||
| SBP Sequence |
>Monobody anti-ICMT MB-15
AVSSVPTKLEVVAATPTSLLISWDAPAVTVDLYVITYGETGGNSPVQEFKVPGSKSTATI SGLKPGVDYTITVYAFSSYYWPSYKGSPISINYRT |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Protein-S-isoprenylcysteine O-methyltransferase | Binder | Cancers [ICD-11: 2D4Z] | N.A. | Memorial Sloan Kettering Cancer Center | [1] | |