Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003137) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-CrSAS-6 clone 15
|
|||||
| Synonyms |
MB-CRS6-15
|
|||||
| Molecular Weight | 9.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Phage display and yeast display | |||||
| Highest Status | Research | |||||
| PDB ID | 6ZZ8; 6ZZG | |||||
| Sequence Length | 94 | |||||
| SBP Sequence |
>Monobody anti-CrSAS-6 clone 15
GSVSSVPTKLEVVAATPTSLLISWDAPAVTVYLYVITYGETGGNSPVQEFEVPGSKSTAT ISGLKPGVDYTITVYASSKHSSRYASPISINYRT |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Centriole protein | Binder | Tools for tuning SAS-6 architecture | Kd: 137 nM | Swiss Federal Institute of Technology Lausanne (EPFL) | [1] | |