Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003136) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-CrSAS-6 clone 13
|
|||||
Synonyms |
MB-CRS6-13
|
|||||
Molecular Weight | 13.0 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Phage display and yeast display | |||||
Highest Status | Research | |||||
PDB ID | 6ZZD | |||||
Sequence Length | 118 | |||||
SBP Sequence |
>Monobody anti-CrSAS-6 clone 13
SSGLNDIFEAQKIEWHEENLYFQGSVSSVPTKLEVVAATPTSLLISWDAPAVTVYFYVIT YGETGGNSPVQEFEVPGSKSTATISGLKPGVDYTITVYANNKYSRWYGISPISINYRT |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Centriole protein | Binder | Tools for tuning SAS-6 architecture | Kd: 134 nM | Swiss Federal Institute of Technology Lausanne (EPFL) | [1] | |