General Information of Synthetic Binding Protein (SBP) (ID: SBP003131)
SBP Name
Monobody anti-SARS-CoV-2 FN3A
Synonyms
Monobody FN3A
Molecular Weight 10.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 92
SBP Sequence
>Monobody anti-Spik RBD FN3A
MAVSDVPRKLEVVAATPTSLLISWDYQYYYYAYYRITYGETGGNSPVQEFTVPYGSYTAT
ISGLKPGVDYTITVYAVTYWSTSFSISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Spike glycoprotein
BTS Info
Binder SARS-CoV-2 infection (COVID-19) [ICD-11: XN109] Kd: 5.56 nM Tango Biosciences, Inc [1]
References
1 FN3-based monobodies selective for the receptor binding domain of the SARS-CoV-2 spike protein. N Biotechnol. 2021 May 25;62:79-85.