Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003080)
SBP Name
scFv anti-E2 m1-e7
Synonyms
scFv m1-e7
Molecular Weight 26.2 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli XL1-Blue
Selection Method Phage display
Highest Status Research
Sequence Length 246
SBP Sequence
>scFv anti-E2 m1-e7
EVPLVESGGGLVKPGGSLKLSCTASGFPFSRSAMSWVRQSPDKRLEWVAEISSGGFYTSY
VDTVTGRFTISRDNAKNILYLEMSSLRSEDTAIYYCARERGIHYYGSSEILDYWGQGTSV
TVSSGGGGSGGGGSGGGGSDILMTQTPSSMSVSLGDTVTITCHASQGVRSYIGWLQQKPG
KSFKGLIYHGTNLEDGISSRFSGRGSGTDYSLTISSLESEDFGDYYCVQYAQFPYTFGGG
TKLEVK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name scFv E4-4
Protein Scaffold Information of This SBP
Scaffold ID PS057
Scaffold Info
[1] , [2] , [3]
Scaffold Name scFv
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Estradiol-17beta
BTS Info
Binder Diagnostic reagent Kd: 3.8 nM Kobe Pharmaceutical University [1] , [2] , [3]
References
1 "Breeding" diagnostic antibodies for higher assay performance: a 250-fold affinity-matured antibody mutant targeting a small biomarker. Anal Chem. 2013 May 21;85(10):4930-7.
2 Two-step in vitro antibody affinity maturation enables estradiol-17beta assays with more than 10-fold higher sensitivity. Anal Chem. 2010 Feb 1;82(3):1027-38.
3 Anti-estradiol-17beta single-chain Fv fragments: Generation, characterization, gene randomization, and optimized phage display. Steroids. 2008 Dec 22;73(14):1485-99.