Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003080) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv anti-E2 m1-e7
|
|||||
| Synonyms |
scFv m1-e7
|
|||||
| Molecular Weight | 26.2 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli XL1-Blue | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 246 | |||||
| SBP Sequence |
>scFv anti-E2 m1-e7
EVPLVESGGGLVKPGGSLKLSCTASGFPFSRSAMSWVRQSPDKRLEWVAEISSGGFYTSY VDTVTGRFTISRDNAKNILYLEMSSLRSEDTAIYYCARERGIHYYGSSEILDYWGQGTSV TVSSGGGGSGGGGSGGGGSDILMTQTPSSMSVSLGDTVTITCHASQGVRSYIGWLQQKPG KSFKGLIYHGTNLEDGISSRFSGRGSGTDYSLTISSLESEDFGDYYCVQYAQFPYTFGGG TKLEVK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | scFv E4-4 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] , [2] , [3] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Estradiol-17beta | Binder | Diagnostic reagent | Kd: 3.8 nM | Kobe Pharmaceutical University | [1] , [2] , [3] | |
| References |
|---|