Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP002002) | ||||||
---|---|---|---|---|---|---|
SBP Name |
GCN4-based binder anti-IL-4R-alpha MAR-IL4
|
|||||
Synonyms |
GCN4-based binder MAR-IL4
|
|||||
Molecular Weight | 4.0 kDa | |||||
Thermal Denaturation TEMP | 83.6 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Highest Status | Research | |||||
Sequence Length | 31 | |||||
SBP Sequence |
>GCN4-based binder anti-IL-4R-alpha MAR-IL4
RMKQLEKKVERLLKRNYRLEWEVIRLKKLVG |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | GCN4 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS036 | [1] | ||||
Scaffold Name | GCN4-based binder | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Two Alpha-Helices | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Interleukin-4 receptor subunit alpha | Antagonist | Tools for molecular recognition | Kd: 26000 nM | European Molecular Biology Laboratory | [1] | |