Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001886) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
OBody anti-HEWL NL8
|
|||||
| Synonyms |
OBody NL8
|
|||||
| Molecular Weight | 11.7 kDa | |||||
| Thermal Denaturation TEMP | 79.6 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli DH5 (alpha) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 4GLA | |||||
| Sequence Length | 109 | |||||
| SBP Sequence |
>OBody anti-HEWL NL8
GSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAGK TPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKAKA |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | OBody | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS050 | [1] | ||||
| Scaffold Name | OBody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Hen egg-white lysozyme | Inhibitor | Tools for molecular recognition | Kd: 35000 nM | University of Waikato; OBodies Limited | [1] | |