Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001645) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv anti-Digoxigenin clone 1.7-1
|
|||||
| Synonyms |
scFv 1.7-1
|
|||||
| Molecular Weight | 26.3 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Escherichia coli display | |||||
| Highest Status | Research | |||||
| Sequence Length | 248 | |||||
| SBP Sequence |
>scFv anti-Digoxigenin clone 1.7-1
HMEVQLQQSGPELVKPGASVRMSCKSSGYIFTDFYMNWVRQSHGKSLDYIGYISPYSGVT GYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAGSSGNKNKAMDYWGHGASVTV SSGGGGSGGGGSGGGGSDIVLTQSPASLAVSLGQRATISCRSSQSLVHSNGNTYLNWYQQ KPGQPPKLLIYKVSNRFSGVPARFSGSGSESDFTLTIDPVGEDDAAIYYCSQTTHVPPTF GSGTKLEL |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | scFv 26-10 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] , [2] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Digoxigenin | Binder | Research tool | N.A. | University of Texas at Austin | [1] , [2] | |
| References |
|---|