General Information of Synthetic Binding Protein (SBP) (ID: SBP001503)
SBP Name
DARPin anti-ERBB2 H10-2-G5
Synonyms
DARPin H10-2-G5
Molecular Weight 13.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Ribosome display
Highest Status Research
Sequence Length 123
SBP Sequence
>DARPin anti-ERBB2 H10-2-G5
DLGKKLLEAARAGQDDEVRILMANGADVNARDEYGLTPLYLAVAHGHLDIVEVLLKNGAD
VNAVDAIGFTPLHLAAFIGHLEIAEVLMKYGADVNTQDKFGKTAFDISIDNGNENLAEIL
QKL
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name N2C
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Receptor tyrosine-protein kinase erbB-2
BTS Info
Binder Tools for detecting Her2 in human carcinoma extracts Kd: 0.67 nM New York University School of Medicine [1]
References
1 A designed ankyrin repeat protein evolved to picomolar affinity to Her2. J Mol Biol. 2007 Jun 15;369(4):1015-28.