Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001502)
SBP Name
DARPin anti-ERBB2 H10-2-G3
Synonyms
DARPin H10-2-G3
Molecular Weight 13.2 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Ribosome display
Highest Status Research
PDB ID 2JAB
Sequence Length 123
SBP Sequence
>DARPin anti-ERBB2 H10-2-G3
DLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGLTPLYLATAHGHLEIVEVLLKNGAD
VNAVDAIGFTPLHLAAFIGHLEIAEVLLKHGADVNAQDKFGKTAFDISIGNGNEDLAEIL
QKL
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name N2C
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1] , [2] , [3]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Receptor tyrosine-protein kinase erbB-2
BTS Info
Binder Tools for detecting Her2 in human carcinoma extracts Kd: 0.091 nM New York University School of Medicine [1] , [2] , [3]
References
1 A designed ankyrin repeat protein evolved to picomolar affinity to Her2. J Mol Biol. 2007 Jun 15;369(4):1015-28.
2 Development of the designed ankyrin repeat protein (DARPin) G3 for HER2 molecular imaging. Eur J Nucl Med Mol Imaging. 2015 Feb;42(2):288-301.
3 Multifunctional superparamagnetic nanoparticles conjugated with fluorescein-labeled designed ankyrin repeat protein as an efficient HER2-targeted probe in breast cancer. Biomaterials. 2017 Dec;147:86-98.