Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001484) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-ERBB2 6L1G
|
|||||
Synonyms |
DARPin 6L1G
|
|||||
Molecular Weight | 13.3 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display and Ribosome display | |||||
Highest Status | Research | |||||
Sequence Length | 125 | |||||
SBP Sequence |
>DARPin anti-ERBB2 6L1G
GSDLGKKLLEAARAGQDDEVRILMANGADVNASGYLGSTPLHLAAIFGHLEIVELLKNGA DVNARDKFGSTPLHLAADYGHVEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEI LQKLN |
|||||
3D Structure |
|
|||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | AR module | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] , [2] , [3] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Receptor tyrosine-protein kinase erbB-2 | Blocker | HER2-positive breast cancer [ICD-11: 2C60-2C65] | N.A. | University of Zurich | [1] , [2] , [3] | |
References |
---|