Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001484)
SBP Name
DARPin anti-ERBB2 6L1G
Synonyms
DARPin 6L1G
Molecular Weight 13.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display and Ribosome display
Highest Status Research
Sequence Length 125
SBP Sequence
>DARPin anti-ERBB2 6L1G
GSDLGKKLLEAARAGQDDEVRILMANGADVNASGYLGSTPLHLAAIFGHLEIVELLKNGA
DVNARDKFGSTPLHLAADYGHVEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEI
LQKLN
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name AR module
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1] , [2] , [3]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Receptor tyrosine-protein kinase erbB-2
BTS Info
Blocker HER2-positive breast cancer [ICD-11: 2C60-2C65] N.A. University of Zurich [1] , [2] , [3]
References
1 Systemic analysis of tyrosine kinase signaling reveals a common adaptive response program in a HER2-positive breast cancer. Sci Signal. 2019 Jan 22;12(565):eaau2875.
2 Designed ankyrin repeat proteins (DARPins) from research to therapy. Methods Enzymol. 2012;503:101-34.
3 Intermolecular biparatopic trapping of ErbB2 prevents compensatory activation of PI3K/AKT via RAS-p110 crosstalk. Nat Commun. 2016 Jun 3;7:11672.