Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001479) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
DARPin anti-TcdB clone 1.2E
|
|||||
| Synonyms |
DARPin 1.2E
|
|||||
| Molecular Weight | 16.2 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 152 | |||||
| SBP Sequence |
>DARPin anti-TcdB clone 1.2E
GKKLLEAARAGQDDEVRILMANGADVNAYDARGVTPLHLAAFSGHLEIVEVLLKNGADVN AIDVIGMTPLHLAAWIGHLEIVEVLLKHGADVNAVDRSGNTPLHLAAWLGHLEIVEVLLK YGADVNAQDKFGKTAFDISIDNGNEDLAEILQ |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | AR module | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS027 | [1] , [2] | ||||
| Scaffold Name | DARPin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Toxin B | Inhibitor | Clostridium difficile infection [ICD-11: XN0SE] | N.A. | Texas A&M University | [1] , [2] | |
| References |
|---|