Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001447) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-ERBB2 F3
|
|||||
Synonyms |
DARPin F3
|
|||||
Molecular Weight | 13.1 kDa | |||||
Thermal Denaturation TEMP | 69 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli M15 | |||||
Selection Method | SNAP display | |||||
Highest Status | Research | |||||
Sequence Length | 123 | |||||
SBP Sequence |
>DARPin anti-ERBB2 F3
DLGKKLLEAARAGQDDEVRILMAIGADVNAKDECGLTPLYLATAHGHLEIVEVLLKNGAD VNAVDAIGFTPLHLAAFIGHLEIVEVLLKHGADVNAQDKFGKTAFDISIGNGNEDLAEIL QKL |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | DARPin H10-2-G3 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Receptor tyrosine-protein kinase erbB-2 | Binder | Research tool | Kd: 1.9 nM | University of Cambridge | [1] | |