General Information of Synthetic Binding Protein (SBP) (ID: SBP001446)
SBP Name
DARPin anti-ERBB2 F1
Synonyms
DARPin F1
Molecular Weight 13.2 kDa
Thermal Denaturation TEMP 56.7 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli M15
Selection Method SNAP display
Highest Status Research
Sequence Length 123
SBP Sequence
>DARPin anti-ERBB2 F1
DLGKKLLEAARAGEDDEVRVLMANGADVNAKDEYGLAPLYHATAHGHLEIVEVLLKNGAD
VNAVDAIGFTPLHLAAFIGHLEIAEVLLRHGADVNAQDKFGKTAFDISIDNVNEDLAEIL
QKL
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name DARPin H10-2-G3
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Receptor tyrosine-protein kinase erbB-2
BTS Info
Binder Research tool Kd: 0.39 nM University of Cambridge [1]
References
1 Directed evolution of anti-HER2 DARPins by SNAP display reveals stability/function trade-offs in the selection process. Protein Eng Des Sel. 2015 Sep;28(9):269-79.