Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001436)
SBP Name
DARPin anti-ERBB1 E01
Synonyms
DARPin E01
Molecular Weight 16.8 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli XL1-Blue
Selection Method Phage display
Highest Status Research
Sequence Length 155
SBP Sequence
>DARPin anti-ERBB1 E01
MDLGKKLLEAARAGQDDEVRILMANGADVNADDTWGWTPLHLAAYQGHLEIVEVLLKNGA
DVNAYDYIGWTPLHLAADGHLEIVEVLLKNGADVNASDYIGDTPLHLAAHNGHLEIVEVL
LKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQL
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name AR module
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1] , [2]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Epidermal growth factor receptor
BTS Info
Binder Cancers [ICD-11: 2D4Z] Kd: 0.5 nM Fred Hutchinson Cancer Research Center; Bielefeld University [1] , [2]
References
1 Multispecific Targeting with Synthetic Ankyrin Repeat Motif Chimeric Antigen Receptors. Clin Cancer Res. 2019 Dec 15;25(24):7506-7516.
2 Bifunctional Reagents for Formylglycine Conjugation: Pitfalls and Breakthroughs. Chembiochem. 2020 Dec 11;21(24):3580-3593.