Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001433) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-HER2/neu clone 9.16
|
|||||
Synonyms |
DARPin 9.16
|
|||||
Molecular Weight | 17.6 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Ribosome display; phage display | |||||
Highest Status | Research | |||||
Sequence Length | 167 | |||||
SBP Sequence |
>DARPin anti-HER2/neu clone 9.16
SSGLVPRGSHMGSDLGKKLLEAARAGQDDEVRILMANGADVNAHDFHGLTPLHLAAGMGH LEIVEVLLKNGADVNAVDTDGITLLHLAAYYGHLEIVEVLLKHGADVNAHDYAGSTPLHL AANTGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNEDLAEILQ |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | N3C | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] , [2] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||