Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001425)
SBP Name
DARPin anti-KRas E3.5
Synonyms
DARPin E3.5
Molecular Weight 16.8 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Human embryonic kidney?cells 293; HCT116 cells
Selection Method Phage display
Highest Status Research
Sequence Length 159
SBP Sequence
>DARPin anti-KRas E3.5
GSDLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLAASNGHLEIVEVLLKNG
ADVNASDLTGITPLHLAAATGHLEIVEVLLKHGADVNAYDNDGHTPLHLAAKYGHLEIVE
VLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name AR module
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1] , [2]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
GTPase KRas
BTS Info
Inhibitor Cancers [ICD-11: 2D4Z] N.A. University of Oxford [1] , [2]
References
1 KRAS-specific inhibition using a DARPin binding to a site in the allosteric lobe. Nat Commun. 2019 Jun 13;10(1):2607.
2 Non-invasive in vivo imaging of tumour-associated cathepsin B by a highly selective inhibitory DARPin. Theranostics. 2017 Jul 8;7(11):2806-2821.