Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001411) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-TFP1 1238_E11
|
|||||
Synonyms |
DARPin 1238_E11
|
|||||
Molecular Weight | 18.2 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli XL1-Blue | |||||
Selection Method | Ribosome display | |||||
Highest Status | Research | |||||
PDB ID | 6FP9 | |||||
Sequence Length | 168 | |||||
SBP Sequence |
>DARPin anti-TFP1 1238_E11
DLGKKLLEAARAGQDDEVRILMANGADVNATDWVGMTPLHLAAWKGHLEIVEVLLKTGAD VNAHDVFGTTPLHLAAHRGHLEIVEVLLKAGADVNAQDMVGKTPLHLAAYYGHLEIVEVL LKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAKLNDYKDDDDK |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Template Name | AR module | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Teal fluorescent protein 1 | Binder | Tools as novel reagents for in vitro and in vivo protein manipulations | Kd: 3 nM | University of Basel | [1] | |