Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001401) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Centyrin anti-ERBB1 83v2
|
|||||
Synonyms |
Centyrin 83v2
|
|||||
Molecular Weight | 11.6 kDa | |||||
Thermal Denaturation TEMP | 71 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Highest Status | Research | |||||
Sequence Length | 103 | |||||
SBP Sequence |
>Centyrin anti-ERBB1 83v2
MLPAPKNLVVSEVTEDSARLSWDDPWAFYESFLIQYQESEKVGEAIVLTVPGSERSYDLT GLKPGTEYTVSIYGVHNVYKDTNMRGLPLSAIFTTGGHHHHHH |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS020 | [1] | ||||
Scaffold Name | Centyrin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Epidermal growth factor receptor | Inhibitor | Tools for targeted delivery | Kd: 0.1 nM | Janssen Research & Development, L.L.C. | [1] | |