Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001401) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Centyrin anti-ERBB1 83v2
|
|||||
| Synonyms |
Centyrin 83v2
|
|||||
| Molecular Weight | 11.6 kDa | |||||
| Thermal Denaturation TEMP | 71 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Highest Status | Research | |||||
| Sequence Length | 103 | |||||
| SBP Sequence |
>Centyrin anti-ERBB1 83v2
MLPAPKNLVVSEVTEDSARLSWDDPWAFYESFLIQYQESEKVGEAIVLTVPGSERSYDLT GLKPGTEYTVSIYGVHNVYKDTNMRGLPLSAIFTTGGHHHHHH |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS020 | [1] | ||||
| Scaffold Name | Centyrin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Epidermal growth factor receptor | Inhibitor | Tools for targeted delivery | Kd: 0.1 nM | Janssen Research & Development, L.L.C. | [1] | |