Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001367)
SBP Name
DARPin anti-ERBB2 clone 9_29
Synonyms
DARPin 9_29
Molecular Weight 17.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Highest Status Research
PDB ID 4HRL
Sequence Length 161
SBP Sequence
>DARPin anti-ERBB2 clone 9_29
GSDLGKKLLEAARAGQDDEVRILMANGADVNAHDFYGITPLHLAANFGHLEIVEVLLKHG
ADVNAFDYDNTPLHLAADAGHLEIVEVLLKYGADVNASDRDGHTPLHLAAREGHLEIVEV
LLKNGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAKLN
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1] , [2] , [3]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Receptor tyrosine-protein kinase erbB-2
BTS Info
Binder Cancers [ICD-11: 2D4Z] Kd: 3.8 nM Uppsala University; University of Southern California [1] , [2] , [3]
References
1 On the prevention of kidney uptake of radiolabeled DARPins. EJNMMI Res. 2020 Feb 4;10(1):7.
2 Designed Ankyrin Repeat Proteins as Her2 Targeting Domains in Chimeric Antigen Receptor-Engineered T Cells. Hum Gene Ther. 2017 Sep;28(9):726-736.
3 Comparative Evaluation of Radioiodine and Technetium-Labeled DARPin 9_29 for Radionuclide Molecular Imaging of HER2 Expression in Malignant Tumors. Contrast Media Mol Imaging. 2018 Jun 6;2018:6930425.