General Information of Synthetic Binding Protein (SBP) (ID: SBP001314)
SBP Name
Monobody anti-GPR56 clone beta15
Synonyms
Monobody mGPR56_beta15
Molecular Weight 10.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display and yeast display
Highest Status Research
Sequence Length 94
SBP Sequence
>Monobody anti-GPR56 clone beta15
VSDVPRDLEVVAATPTSLLISWDASSSSVSYYRITYGETGGNSPVQEFTVPGSSSTATIS
GLKPGVDYTITVYAGVGNYKYWWGSSPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name 10th domain of fibronectin type III (10Fn3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Adhesion G-protein coupled receptor G1
BTS Info
Binder aGPCR-targeted therapeutics N.A. University of Chicago [1]
References
1 Stachel-independent modulation of GPR56/ADGRG1 signaling by synthetic ligands directed to its extracellular region. Proc Natl Acad Sci U S A. 2017 Sep 19;114(38):10095-10100.