Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001293) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-SHP2 NSa2
|
|||||
| Synonyms |
Monobody NSa2
|
|||||
| Molecular Weight | 9.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Human embryonic kidney?cells 293; K562 Cells | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| Sequence Length | 91 | |||||
| SBP Sequence |
>Monobody anti-SHP2 NSa2
VSDVPRDLEVVAATPTSLLISWDAPAVTVDYYVITYGETGYYAYFQEFEVPGSKSTATIS GLKPGVDYTITVYAAGYGYAYGSPISINYRT |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Fibronectin type III domain (FN3) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Src-homology 2 domain-containing phosphatase 2 | Inhibitor | Chronic myeloid leukaemia [ICD-11: 2B33.2] | Kd: 170 nM | University of Chicago | [1] | |