General Information of Synthetic Binding Protein (SBP) (ID: SBP001293)
SBP Name
Monobody anti-SHP2 NSa2
Synonyms
Monobody NSa2
Molecular Weight 9.9 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Human embryonic kidney?cells 293; K562 Cells
Selection Method Yeast display
Highest Status Research
Sequence Length 91
SBP Sequence
>Monobody anti-SHP2 NSa2
VSDVPRDLEVVAATPTSLLISWDAPAVTVDYYVITYGETGYYAYFQEFEVPGSKSTATIS
GLKPGVDYTITVYAAGYGYAYGSPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Src-homology 2 domain-containing phosphatase 2
BTS Info
Inhibitor Chronic myeloid leukaemia [ICD-11: 2B33.2] Kd: 170 nM University of Chicago [1]
References
1 Dissection of the BCR-ABL signaling network using highly specific monobody inhibitors to the SHP2 SH2 domains. Proc Natl Acad Sci U S A. 2013 Sep 10;110(37):14924-9.