Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001276)
SBP Name
Monobody anti-Bpe clone L3
Synonyms
Monobody Bpe-L3
Molecular Weight 10.0 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display and yeast display
Highest Status Research
Sequence Length 90
SBP Sequence
>Monobody anti-Bpe clone L3
VSSVPTKLEVVAATPTSLLISWDAYYDEVMYYRITYGETGGNSPVQEFTVPGSSSTATIS
GLKPGVDYTITVYAYWGEWYFSPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Template Sequence Description X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp and 2.5% each of all the other amino acids except for Cys; B denotes a mixture of Gly, Ser and Tyr; J denotes a mixture of Ser and Tyr.
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2] , [3]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Fluc channel homologue Bpe
BTS Info
Inhibitor Tools for inhibiting dual topology fluoride channels Kd: 58 nM Brandeis University; Stanford University School of Medicine [1] , [2] , [3]
References
1 Proof of dual-topology architecture of Fluc F- channels with monobody blockers. Nat Commun. 2014 Oct 7;5:5120.
2 Mechanism of single- and double-sided inhibition of dual topology fluoride channels by synthetic monobodies. J Gen Physiol. 2017 Apr 3;149(4):511-522.
3 Two-sided block of a dual-topology F- channel. Proc Natl Acad Sci U S A. 2015 May 5;112(18):5697-701.