Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001276) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-Bpe clone L3
|
|||||
Synonyms |
Monobody Bpe-L3
|
|||||
Molecular Weight | 10.0 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display and yeast display | |||||
Highest Status | Research | |||||
Sequence Length | 90 | |||||
SBP Sequence |
>Monobody anti-Bpe clone L3
VSSVPTKLEVVAATPTSLLISWDAYYDEVMYYRITYGETGGNSPVQEFTVPGSSSTATIS GLKPGVDYTITVYAYWGEWYFSPISINYRT |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Fibronectin type III domain (FN3) | |||||
Template Sequence Description | X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp and 2.5% each of all the other amino acids except for Cys; B denotes a mixture of Gly, Ser and Tyr; J denotes a mixture of Ser and Tyr. | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] , [2] , [3] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Fluc channel homologue Bpe | Inhibitor | Tools for inhibiting dual topology fluoride channels | Kd: 58 nM | Brandeis University; Stanford University School of Medicine | [1] , [2] , [3] | |
References |
---|