Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001249) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-SARS-CoV-2 clone 10
|
|||||
| Synonyms |
Monobody clone 10
|
|||||
| Molecular Weight | 11.1 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Transcription-translation coupled with association of PuL display | |||||
| Highest Status | Research | |||||
| Sequence Length | 101 | |||||
| SBP Sequence |
>Monobody anti-SARS-CoV-2 clone 10
VSDVPRDLEVVAATPTSLLISWDAGHQDYGVSVRYYRITYGETGGNSPVQEFTVPGSKST ATISGLKPGVDYTITVYAVTYYMGPDVYGRSEYPISINYRT |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | 10th domain of fibronectin type III (10Fn3) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Spike glycoprotein | Inhibitor | SARS-CoV-2 infection (COVID-19) [ICD-11: XN109] | Kd: 2.0 nM | Nagoya University | [1] | |