General Information of Synthetic Binding Protein (SBP) (ID: SBP001248)
SBP Name
Monobody anti-SARS-CoV-2 clone 9
Synonyms
Monobody clone 9
Molecular Weight 10.9 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Transcription-translation coupled with association of PuL display
Highest Status Research
Sequence Length 100
SBP Sequence
>Monobody anti-SARS-CoV-2 clone 9
VSDVPRDLEVVAATPTSLLISWDAVYNVYPGTVRYYRITYGETGGNSPVQEFTVPGSKST
ATISGLKPGVDYTITVYAVTGSGVKYVVYRRSPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name 10th domain of fibronectin type III (10Fn3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Spike glycoprotein
BTS Info
Inhibitor SARS-CoV-2 infection (COVID-19) [ICD-11: XN109] Kd: 17.8 nM Nagoya University [1]
References
1 Antibody-like proteins that capture and neutralize SARS-CoV-2. Sci Adv. 2020 Oct 14;6(42):eabd3916.