Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001215)
SBP Name
Monobody anti-Bpe L2
Synonyms
Monobody L2
Molecular Weight 10.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Highest Status Research
PDB ID 5NKQ
Sequence Length 92
SBP Sequence
>Monobody anti-Bpe L2
SVSSVPTKLEVVAATPTSLLISWDAYYDEVMYYRITYGETGGNSPVQEFTVPGSSSTATI
SGLKPGVDYTITVYAYYDSYGHWSPISINYRT
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Template Sequence Description X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp and 2.5% each of all the other amino acids except for Cys; B denotes a mixture of Gly, Ser and Tyr; J denotes a mixture of Ser and Tyr.
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2] , [3]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Fluc channel homologue Bpe
BTS Info
Binder Tools as monobody inhibitor N.A. Brandeis University [1] , [2] , [3]
References
1 Crystal structures of a double-barrelled fluoride ion channel. Nature. 2015 Sep 24;525(7570):548-51.
2 Mechanism of single- and double-sided inhibition of dual topology fluoride channels by synthetic monobodies. J Gen Physiol. 2017 Apr 3;149(4):511-522.
3 Proof of dual-topology architecture of Fluc F- channels with monobody blockers. Nat Commun. 2014 Oct 7;5:5120.