Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001214)
SBP Name
Monobody anti-Bpe S7
Synonyms
Monobody S7
Molecular Weight 10.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Highest Status Research
PDB ID 5A40
Sequence Length 91
SBP Sequence
>Monobody anti-Bpe S7
VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGAYWSYQEFTVPGSKTTATIS
GLKPGVDYTITVYAYWEHMYHYSPISINYRT
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Template Sequence Description X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp, and 2.5% each of all the other amino acids except for Cys; O denotes a mixture of Asn, Asp, His, Ile, Leu, Phe, Tyr, and Val; U denotes a mixture of His, Leu, Phe, and Tyr; Z denotes a mixture of Ala, Glu, Lys, and Thr.
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Fluc channel homologue Bpe
BTS Info
Binder Research tool N.A. Brandeis University [1] , [2]
References
1 Crystal structures of a double-barrelled fluoride ion channel. Nature. 2015 Sep 24;525(7570):548-51.
2 Proof of dual-topology architecture of Fluc F- channels with monobody blockers. Nat Commun. 2014 Oct 7;5:5120.