Details of the SBP | SYNBIP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001170)
SBP Name	Monobody anti-Fgr-SH2/Src-SH2/Yes-SH2 clone 1
Synonyms	Monobody Fgr_1
Molecular Weight	10.0 kDa
Design Method	Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method	Phage display, Yeast display and Fluorescence-activated cell sorting
Highest Status	Research
Sequence Length	93
SBP Sequence	>Monobody anti-Fgr-SH2/Src-SH2/Yes-SH2 clone 1 VSSVPTKLEVVAATPTSLLISWDAPAVTVHYYVITYGETGGNSPVQEFTVPGSKSTATIS GLKPGVDYTITVYALYGSLYYDYPSPISINYRT
Template Name	Fibronectin type III domain (FN3)
Template Sequence Description	X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp, and 2.5% each of all the other amino acids except for Cys; O denotes a mixture of Asn, Asp, His, Ile, Leu, Phe, Tyr, and Val; U denotes a mixture of His, Leu, Phe, and Tyr; Z denotes a mixture of Ala, Glu, Lys, and Thr.

Protein Scaffold Information of This SBP
Scaffold ID	PS047 Scaffold Info					[1]
Scaffold Name	Monobody
Scaffold Class	Non-Antibody
Fold Type	Beta-Sheets + Loops

Binding Target(s) of This SBP (BTS)

BTS Name	Details	Mechanism	Application	Affinity	Research Organization	Ref
SrcA subgroup Fgr-Src-homology 2	BTS Info	Inhibitor	Tools for dissecting SFK functions in normal development and signaling	Kd: 151 nM	Swiss Institute for Experimental Cancer Research (ISREC)	[1]
SrcA subgroup Src-Src-homology 2	BTS Info	Inhibitor	Tools for dissecting SFK functions in normal development and signaling	Kd: 1105 nM	Swiss Institute for Experimental Cancer Research (ISREC)	[1]
SrcA subgroup Yes-Src-homology 2	BTS Info	Inhibitor	Tools for dissecting SFK functions in normal development and signaling	Kd: 456 nM	Swiss Institute for Experimental Cancer Research (ISREC)	[1]

References

1

Selective Targeting of SH2 Domain-Phosphotyrosine Interactions of Src Family Tyrosine Kinases with Monobodies. J Mol Biol. 2017 May 5;429(9):1364-1380.