Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001097) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-GlyT1 clone 2
|
|||||
Synonyms |
Sb-GlyT1#2
|
|||||
Molecular Weight | 12.4 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Ribosome display | |||||
Highest Status | Research | |||||
Sequence Length | 114 | |||||
SBP Sequence |
>Nanobody anti-GlyT1 clone 2
QVQLVESGGGLVQAGGSLRLSCAASGFPVYHRSMLWYRQAPGKEREWVAAIKSNGAGTWY ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCTVGVGTNYWGQGTQVTVS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Concave scaffold | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Sodium- and chloride-dependent glycine transporter 1 | Binder | Tools for the conformational trapping of membrane proteins | Kd: 2520 nM | University of Zurich | [1] | |