Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001071) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-KDELR2 clone 37
|
|||||
| Synonyms |
Syb37
|
|||||
| Molecular Weight | 13.6 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Phage display and Ribosome display | |||||
| Highest Status | Research | |||||
| PDB ID | 6I6J | |||||
| Sequence Length | 121 | |||||
| SBP Sequence |
>Nanobody anti-KDELR2 clone 37
QVQLVESGGGLVQAGGSLRLSCAASGFPVKRWSMTWYRQAPGKEREWVAAIRSAGHWTHY ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDEGDFSYWYDYWGQGTQVTVS A |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] , [2] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||