General Information of Synthetic Binding Protein (SBP) (ID: SBP001061)
SBP Name
Nanobody anti-BtuF clone 7
Synonyms
Nb7
Molecular Weight 14.2 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli WK6
Selection Method Phage display
Highest Status Research
Sequence Length 136
SBP Sequence
>Nanobody anti-BtuF clone 7
MKYLLPTAAAGLLLLAAQPAMAQGQLVESGGGLVQPGGSLRLSCVASGFDFSNYTMSWVR
QAPGKGLEWVSDISSGGGSTYYADSVKGRFTISRDNAKNTVYLQMNTLKPEDTAVYLCTE
LGVAPPGQGTRVTVSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Vitamin B12-binding protein
BTS Info
Inhibitor Research tool Kd: 24 nM ETH Zurich [1]
References
1 Structural basis of nanobody-mediated blocking of BtuF, the cognate substrate-binding protein of the Escherichia coli vitamin B12 transporter BtuCD. Sci Rep. 2017 Oct 30;7(1):14296.