Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001043) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-SARS-CoV-2 clone 68
|
|||||
| Synonyms |
Anti-COVID Sb#68; Anti-COVID sybody 68; Synthetic anti-COVID nanobody 68; Sb68
|
|||||
| Molecular Weight | 13.4 kDa | |||||
| Thermal Denaturation TEMP | 78.4 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| PDB ID | 7KLW; 7MFU; 7P77; 7P78; 7P7A | |||||
| Sequence Length | 124 | |||||
| SBP Sequence |
>Nanobody anti-SARS-CoV-2 spike protein clone 68
QVQLVESGGGSVQAGGSLRLSCAASGSISSITYLGWFRQAPGKEREGVAALITVNGHTYY ADSVKGRFTVSLDNAKNTVYLQMNSLKPEDTALYYCAAAAWGYAWPLHQDDYWYWGQGTQ VTVS |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Spike glycoprotein | Inhibitor | SARS-CoV-2 infection (COVID-19) [ICD-11: XN109] | Kd: 41-670 nM | National Institutes of Health | [1] | |