Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001028) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-SARS-CoV-2 matured clone 6
|
|||||
Synonyms |
Matured Nb6; mNb6
|
|||||
Molecular Weight | 13.6 kDa | |||||
Thermal Denaturation TEMP | 67.6 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Selection Method | Yeast display | |||||
Highest Status | Research | |||||
PDB ID | 7KKJ; 7KKL | |||||
Sequence Length | 119 | |||||
SBP Sequence |
>Nanobody anti-SARS-CoV-2 matured clone 6
QVQLVESGGGLVQAGGSLRLSCAASGYIFGRNAMGWYRQAPGKERELVAGITRRGSITYY ADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADPASPAYGDYWGQGTQVTVSS |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Nb6 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Spike glycoprotein | Inhibitor | SARS-CoV-2 infection (COVID-19) [ICD-11: XN109] | Kd: 0.45 nM | University of California at San Francisco | [1] | |