Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001023) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Diabody anti-CD47 Hu5F9-G4
|
|||||
| Synonyms |
Diabody Hu5F9-G4
|
|||||
| Molecular Weight | 25.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| PDB ID | 5IWL | |||||
| Sequence Length | 234 | |||||
| SBP Sequence |
>Diabody anti-CD47 Hu5F9-G4
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYNMHWVRQAPGQRLEWMGTIYPGNDDTSY NQKFKDRVTITADTSASTAYMELSSLRSEDTAVYYCARGGYRAMDYWGQGTLVTVSSGGS GGDIVMTQSPLSLPVTPGEPASISCRSSQSIVYSNGNTYLGWYLQKPGQSPQLLIYKVSN RFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPYTFGQGTKLEIK |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Hu5F9-G4 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS031 | [1] | ||||
| Scaffold Name | Diabody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Leukocyte surface antigen CD47 | Antagonist | Small-cell lung cancer [ICD-11: 2C25.1] | N.A. | Institute for Stem Cell Biology and Regenerative Medicine | [1] | |