Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000994) | ||||||
---|---|---|---|---|---|---|
SBP Name |
VL dAb anti-HIV-1 D104
|
|||||
Synonyms |
VL D104
|
|||||
Molecular Weight | 13.3 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 133 | |||||
SBP Sequence |
>VL dAb anti-HIV-1 D104
ELVLTQTPSSVSAAVGGTVTINCSGGGSYYYTASEYTYYGSGGGSWYQQKPGQRPKLLIY GASDLASGVSSRFKGSGSGTQFTLTISGVQCADAATYYCSGGGSTAYSSSGGTYAYSGGG SFAFGGGTELEIL |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS064 | [1] | ||||
Scaffold Name | VL dAb | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Envelope glycoprotein gp160 | Inhibitor | Human immunodeficiency virus type 1 infection [ICD-11: XN8LD] | IC50: 9.7 nM | Universidade de Lisboa | [1] | |