Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000993) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
VL dAb anti-HIV-1 F63
|
|||||
| Synonyms |
VL F63
|
|||||
| Molecular Weight | 13.3 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 133 | |||||
| SBP Sequence |
>VL dAb anti-HIV-1 F63
ELVLTQTPSSVSAAVGGTVTINCSGGGSDSTDYCKGYANYSGGGSWYQQKPGQRPKLLIY GASDLASGVSSRFKGSGSGTQFTLTISGVQCADAATYYCSGGGSSTYAYAYSSGAYSGGG SFAFGGGTELEIL |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS064 | [1] | ||||
| Scaffold Name | VL dAb | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Envelope glycoprotein gp160 | Inhibitor | Human immunodeficiency virus type 1 infection [ICD-11: XN8LD] | N.A. | Universidade de Lisboa | [1] | |