Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000982)
SBP Name
Human VH dAb anti-HIV-1 M36
Synonyms
Human VH dAb M36
Molecular Weight 15.0 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Phage display
Highest Status Research
Sequence Length 117
SBP Sequence
>Human VH dAb anti-HIV-1 M36
QVQLVQSGGGLVQPGGSLRLSCAASAFDFSDYEMSWVRQAPGKGLEWIGEINDSGNTIYN
PSLKSRVTISRDNSKNTLYLQMNTLRAEDTAIYYCAIYGGNSGGEYWGQGTLVTVSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name VH m0
Protein Scaffold Information of This SBP
Scaffold ID PS039
Scaffold Info
[1] , [2]
Scaffold Name Human VH dAb
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Envelope glycoprotein gp160
BTS Info
Inhibitor Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] N.A. National Institutes of Health [1] , [2]
References
1 Human domain antibodies to conserved sterically restricted regions on gp120 as exceptionally potent cross-reactive HIV-1 neutralizers. Proc Natl Acad Sci U S A. 2008 Nov 4;105(44):17121-6.
2 Construction of a large phage-displayed human antibody domain library with a scaffold based on a newly identified highly soluble, stable heavy chain variable domain. J Mol Biol. 2008 Oct 10;382(3):779-89.