General Information of Synthetic Binding Protein (SBP) (ID: SBP000967)
SBP Name
Human VH dAb anti-OxGly VH-Ox41
Synonyms
Human VH dAb Ox41
Molecular Weight 13.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 123
SBP Sequence
>Human VH dAb anti-OxGly VH-Ox41
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKEREGVSAVSSGGSTYYA
DSVKGRFTISRDNSKNTLYLQMRAEDTAVYYCARIFRTLSRPPRPPFDYFDYWGQGTLVT
VSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name VH
Protein Scaffold Information of This SBP
Scaffold ID PS039
Scaffold Info
[1]
Scaffold Name Human VH dAb
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
OxGly
BTS Info
Binder Research tool Kd: 392 nM MRC Laboratory of Molecular Biology [1]
References
1 Antibody VH domains as small recognition units. Biotechnology (N Y). 1995 May;13(5):475-9.