Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000965) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Human VH dAb anti-ERBB1 aEG6B2
|
|||||
Synonyms |
Human VH dAb aEG6B2
|
|||||
Molecular Weight | 15 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 124 | |||||
SBP Sequence |
>Human VH dAb anti-ERBB1 aEG6B2
MAQVQLLESGGGLVQPGGSLRLSCAASGFNVNPKYMTWVRQAPGKGLEWVSSIRSPGGST YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASVSRDEKYMRFWGQGTLVTVS SAAA |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Human V3-23/D47 VH | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS039 | [1] | ||||
Scaffold Name | Human VH dAb | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Epidermal growth factor receptor | Inhibitor | Tumors [ICD-11: XH1N44] | N.A. | Jinan University | [1] | |