General Information of Synthetic Binding Protein (SBP) (ID: SBP000964)
SBP Name
Human VH dAb anti-ERBB1 aEG4D9
Synonyms
Human VH dAb aEG4D9
Molecular Weight 15 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 127
SBP Sequence
>Human VH dAb anti-ERBB1 aEG4D9
MAQVQLLESGGGLVQPGGSLRLSCAASGDMLSPDNMTWVRQAPGKGLEWVSTIHKTDGST
YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGLRSRGLSSKYLEYWGQGTLV
TVSSAAA
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Human V3-23/D47 VH
Protein Scaffold Information of This SBP
Scaffold ID PS039
Scaffold Info
[1]
Scaffold Name Human VH dAb
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Epidermal growth factor receptor
BTS Info
Inhibitor Tumors [ICD-11: XH1N44] N.A. Jinan University [1]
References
1 Novel single-domain antibodies against the EGFR domain III epitope exhibit the anti-tumor effect. J Transl Med. 2020 Oct 6;18(1):376.