Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000963) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Human VH dAb anti-ERBB1 aEG2E12
|
|||||
| Synonyms |
Human VH dAb aEG2E12
|
|||||
| Molecular Weight | 15 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 125 | |||||
| SBP Sequence |
>Human VH dAb anti-ERBB1 aEG2E12
MAQVQLLESGGGLVQPGGSLRLSCAASGYSSNNEFMAWVRQAPGKGLEWVSAISTRNGST YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGVSYRRPQQLKYWGQGTLVTV SSAAA |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Human VH V3-23/D47 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS039 | [1] | ||||
| Scaffold Name | Human VH dAb | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Epidermal growth factor receptor | Inhibitor | Tumors [ICD-11: XH1N44] | N.A. | Jinan University | [1] | |