Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000889) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Gp2-based binder anti-IgG GalphaRIgG(3.2.3)
|
|||||
| Synonyms |
Gp2-based binder GalphaRIgG(3.2.3)
|
|||||
| Molecular Weight | 7.2 kDa | |||||
| Thermal Denaturation TEMP | 80 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| Sequence Length | 64 | |||||
| SBP Sequence |
>Gp2-based binder anti-IgG GalphaRIgG(3.2.3)
MSNVNTGSLSVDNKKFWATVHSVHGYFEVPIYAETLDEALELAEWQYGNALGYVTRVRPC VAPK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Gp2 domain | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS038 | [1] | ||||
| Scaffold Name | Gp2-based binder | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Immunoglobulin G | Binder | Research tool | Kd: 1 nM | University of Minnesota | [1] | |